Protein Solutions for Biotherapeutics
eBook
Published: July 4, 2025
Brought to you by
Thermo Fisher Scientific
Thermo Fisher Scientific is the world leader in serving science. They provide cutting-edge technologies, innovative solutions and comprehensive services to a diverse range of industries, including pharmaceuticals, biotechnology, academia and healthcare. Their commitment to excellence and customer satisfaction drives them to continually push the boundaries of science and technology.
Credit: Thermo Fisher Scientific
Protein therapeutics, like monoclonal antibodies and biosimilars, are produced using recombinant DNA technology. This process is complex and subject to risks of degradation and contamination, as temperature, storage conditions and changes in pH can negatively impact the final product. Analytical approaches and workflows play a crucial role in comprehensive characterization, saving time and development costs.
Thermo Fisher Scientific solutions are fit-for-purpose for monitoring product microheterogeneity throughout process development and manufacturing, helping to ensure drug safety and efficacy.
Download this eBook to discover:
- Efficient, high-throughput analysis approaches for rapid results
- Workflows for higher-order structure and more targeted analysis such as subunit and host cell protein assessment
- Integrated, compliance-ready software solutions
Protein solutions eBook
Biopharma
2
3
Enabling every step in your protein
therapeutics journey
Early development phases identify
potential molecules to develop
as drug candidates. Includes the
search for pipeline candidates.
Requires: High-throughput
capabilities and versatile,
advanced tools.
In process development, an
in-depth understanding of process
effect on biomolecules allows for
quicker progression through the
development pipeline.
Requires: Robust and reproducible
analyses to monitor molecular attribute
changes with speed and confidence.
At this stage, the analytical focus
shifts to gaining a deep product
understanding.
Requires: Advanced tools to
answer in-depth molecular
questions with full confidence.
Early discovery
and research
Product
characterization
Process and analytical
development
From discovery to commercialization, Thermo Fisher Scientific provides expertise and a
superior array of scalable tools, services, and support, designed to deliver high-quality
results and accelerate your productivity and innovation.
Small changes in manufacturing
conditions can have a significant
impact on product quality.
To ensure the release of
safe and effective products,
advanced analytical methods are
implemented to closely monitor
CQAs for each batch.
Requires: Reproducible,
robust, GMP compliance-ready
methods.
Quality control
and manufacturing
Protein therapeutics are a type of biotherapeutics derived
from genetically engineered human proteins. They offer
several advantages over small-molecule drugs, allowing
for more precise targeting of complex functions.
Compared to chemical drug production, the production process for protein-based
therapeutics is intricate and variable, with a higher risk of product degradation
and contamination. The final product is fragile and can be affected by factors like
temperature, storage duration, denaturants, solvents, oxygen, and pH changes.
As a result, protein biologics require strict controls in manufacturing, transport and
storage. An array of analytical approaches and workflows facilitate comprehensive
characterization, allowing for full product understanding which can save significant
time and development costs.
Throughout process development and manufacturing, these analytical tools are
required for reliable monitoring of product microheterogeneity ensuring drug safety
and efficacy.
This eBook will provide a comprehensive explanation of the different workflows
specifically designed for protein analysis, highlighting the benefits that each
workflow offers.
Protein therapeutics:
At a glance
4 5 Learn more about intact protein analysis
Thermo Scientific™
Orbitrap Exploris™ 240 MS
Excellent sensitivity, allows the
use of much less sample for high
quality intact MS analysis
Thermo Scientific™
Orbitrap Exploris™ MX MS
Built for usage in the routine
environment
Complemented by
compliance-ready software
Thermo Scientific™ Chromeleon™
Biotherapeutic
protein
Value-added workflow benefits
• Direct infusion techniques or separation allow
intact protein analysis
• Screen, identify, and characterize intact proteins
with higher productivity and confidence using the
Intact Protein workflow in Thermo Scientific™
BioPharma Finder™ software
• BioPharma mass extension available for
Orbitrap Exploris 240 and 480
• Quickly confirm intact protein molecular
weight and determine glycoform heterogeneity
of biopharmaceuticals
Thermo Scientific™
Orbitrap Exploris™ 480 MS
Intuitive instrument control for
easy execution of analysis
Easy-to-use software for data
processing
Intact protein analysis
Efficient intact protein analysis for rapid
assessment enabling confident identification
There is a need for a more efficient protein analysis approach that saves time on sample
preparation and offers simple data analysis. The ideal solution provides high throughput,
information-rich data, and fast assessment of post-translational modification levels.
Webinar - Workflows for robust and sensitive separation of mAbs, intact proteins
at subunit and peptide level using capillary chromatography by LC-MS
Thermo Scientific™ Orbitrap™ Ascend
Tribrid™ Biopharma mass spectrometer
CID and HCD, optionally with UVPD, ETD,
PCTR, can be used in any MS stage, followed
by mass analysis in either the ion trap or ultrahigh resolution Orbitrap mass analyze
Early discovery and research Development QC
Use the wheel to navigate to your area of interest.
Protein therapeutics
workflows
Intact protein analysis
Native intact analysis
Aggregate analysis
Subunit analysis
Glycan
analysis
Higher order
structure analysis
Charge
variant
analysis
Peptide mapping
Multi-attribute
method
Host cell protein
analysis
6 7 Learn more about intact protein analysis
Intact protein analysis under
near-native conditions
Analysis of intact proteins and protein-complexes,
in their true biological states
Analyzing complex therapeutic proteins like antibody-drug conjugates (ADCs) is a significant challenge. The Thermo Scientific
Orbitrap Exploris mass spectrometers, coupled with size exclusion or ion exchange chromatography and compatible buffers,
enable routine intact protein analysis under native conditions.
Webinar - NIBRT: Ion exchange chromatography hyphenated to mass spectrometry
for fast and robust characterization of mAb variants under native conditions
Thermo Scientific™
Orbitrap Exploris™ 480 MS
Intuitive instrument control
for easy execution of analysis
Easy-to-use software for
data processing
Thermo Scientific™
Orbitrap Exploris™ 240 MS
Excellent sensitivity, allowing
the use of much less sample
for high quality native MS
analysis
Thermo Scientific™
Orbitrap Exploris™ MX MS
Built for usage in the routine
environment. Complemented
by compliance-ready software
Thermo Scientific™ Chromeleon™
Biotherapeutic
protein
Early discovery and research
Thermo Scientific™ Orbitrap™
Ascend Tribrid™ Biopharma mass
spectrometer
Advanced MS capabilities and optional
mass range of up to 16’000 m/z allow
scientists to take advantage of versatile
fragmentation techniques and advanced
ion reaction techniques like proton transfer
charge reduction
Development
Thermo Scientific™
Q Exactive™ UHMR MS
The first UHMR MS to combine
substantially increased sensitivity
and mass resolution at high m/z,
MS2, and psuedo-MS3
capabilities in a single platform
QC
Value-added workflow benefits
• Use Thermo Scientific MAbPac SEC-1 Size Exclusion
Columns for high-resolution separation of monoclonal
antibody (mAb) analysis, including monomers and aggregates
• BioPharma option to extend mass range available for the
Orbitrap Exploris 240 and 480 MS systems
• Excellent mass spectrometric data, intuitive instrument
control and easy-to-use software for data processing
• Q Exactive™ UHMR Hybrid Quadrupole Orbitrap™
Mass Spectrometer offers precise mass determination,
peak interference mitigation, and the ability to study
heterogeneous protein assemblies
Learn more about aggregate analysis
Thermo Scientific™ Vanquish™ Duo UHPLC System
The Vanquish Duo UHPLC system provides two independent
flow paths connected to two individual detectors. This unique
system lets you run two analyses in parallel, either identical or
not, on a single system to double throughput, accelerate method
development, and improve sample characterization
Aggregated
proteins
Value-added workflow benefits
• High resolution separation of fragments, monomers
and aggregates
• BioPharma option to extend mass range available
for the Orbitrap Exploris 240 MS
• Thermo Scientific™ Vanquish™ Duo UHPLC system for
Dual LC provides simple and rapid high-throughput
analysis of aggregates
• Compliance-ready analytical setup using
Thermo Scientific™ Chromeleon™ software for
the monitoring stage
Aggregate analysis
High resolution separation of monomers and aggregate peaks
Video - Application Note Video - A universal Chromatography Method
for Aggregate Analysis of Monoclonal Antibodies
The consistent quality of biologic products must be ensured by monitoring protein aggregates throughout
the production process, as aggregates can have serious negative effects. Failure to monitor protein
aggregates can result in incorrect drug dosage, decreased solubility, and activity loss.
Thermo Scientific™ Vanquish™ UHPLC System &
Thermo Scientific™ Orbitrap Exploris 240 MS
Aggregate analysis by HRAM MS facilitates the analysis of
the proteins in their native form, without the need for sample
preparation, while providing information on aggregation
and fragmentation
Characterization Routine monitoring
8 9 Learn more about subunit analysis
Subunits
Value-added workflow benefits
• Subunits are readily separated by reversed-phase (RP)
UHPLC using Thermo Scientific MAbPac RP columns
• Deconvolution of subunit mass spectrometry (MS)
spectra is easy with powerful Thermo Scientific
BioPharma Finder software
• Thermo Scientific™ Pierce Fab Preparation Kit uses
immobilized pepsin protease to digest human or
mouse IgG antibodies to make separate Fab and Fc
antibody fragments
Subunit analysis
Easy deconvolution by harnessing the power of
Thermo Scientific BioPharma Finder Software
Monoclonal antibody (mAb) subunit analysis involves the antibody fragmentation through digestion and reduction
of IgG antibody molecules. The cysteine protease produced by S.pyogenes, known as IdeS, is highly specific.
IdeS digestion followed by reduction generates three subunits that are readily separated by reversed-phase (RP)
UHPLC using Thermo Scientific MAbPac RP columns. Deconvolution of subunit mass spectrometry (MS) spectra
is easy with powerful Thermo Scientific BioPharma Finder software.
Webinar - Workflows for robust and sensitive separation of mAbs, intact proteins
at subunit and peptide level using capillary chromatography by LC-MS
Thermo Scientific™ Orbitrap™ Ascend Tribrid™
Biopharma mass spectrometer
Quantify more samples at lower concentrations
using faster acquisition, while achieving greater
coverage using a revolutionary new hardware
design featuring dual ion routing multipoles
Vanquish UHPLC System &
Orbitrap Exploris 240 MS
The extreme resolving power of the
Thermo Scientific Orbitrap mass analyzer
ensures isotopic resolution of monoclonal
antibody subunits and facilitates middledown sequencing.
Thermo Scientific™ Vanquish UHPLC System
Take advantage of MAbPac SEC-1 columns
which offer superior, reproducible separation of
monomers, aggregates, and fragments resulting
from proteolysis
Characterization Routine monitoring
Learn more about higher order structure analysis
Biotherapeutic
protein
Value-added workflow benefits
• Sample preparation and labelling is made easy by our partners,
Trajan Scientific and Medical. Trajan’s LEAP HDX sampler system
enables automated labelling and digestion
• The Vanquish Neo UHPLC system combines an unrivaled degree of
innovation to deliver 24/7 reproducible separations of complex mixtures at
maximum performance for a variety of high-sensitivity LC-MS workflows
Higher order structure analysis
A robust method for the analysis of protein conformation,
conformation dynamics, and protein-protein interactions
Full structural characterization is critical where local conformational changes can impact safety and
efficacy. Hydrogen deuterium exchange (HDX) mass spectrometry (MS) is a powerful analytical
approach for studying the dynamics of higher order structure of protein-based therapeutics. We offer
a unique total solution for your HDX workflow.
Webinar - Dr Patrick Griffin - Hijacking Molecular Plasticity to Fine Tune Nuclear
Receptor Signaling: Chemical Biology and Precision Therapeutics
Thermo Scientific™ Orbitrap
Exploris™ 480 MS
Intuitive instrument control for
easy execution of analysis
Easy-to-use software for data
processing
Thermo Scientific™ Orbitrap
Exploris™ 240 MS
Thermo Scientific™ Orbitrap
Exploris™ 240 mass spectrometer
fast tracks your path to highconfidence data and identification
Thermo Scientific™ Neo™ Nano LC &
Thermo Scientific™ Orbitrap™ Ascend Tribrid™
Biopharma mass spectrometer
Delivering the ultimate flexibility to expand experimental
scope, and with built-in intelligence, Orbitrap™ Ascend
Tribrid™ Biopharma mass spectrometer ensures the
highest data quality for HDX-MS experiments
• Thermo Scientific BioPharma Finder software
supports all HDX-MS data analysis, including
peptide identification, PTM analysis and
HDX-unique protection factor plots at the
single residue level
Early discovery and research Development
10 11 Learn more about charge variant analysis
Biotherapeutic
proteins
Value-added workflow benefits
• Simplified and fast ion exchange analysis (IEX) of charge
variants using a pH gradient
• Obtain fast and highly robust, reproducible HPLC
gradients using Thermo Scientific™ CX-1 pH gradient
buffer kits. The CX-1 buffers save time in method
development, facilitate method transfer to QA/QC
• The Orbitrap Exploris 240 MS offers high sensitivity,
allowing for the detection and quantification of low
abundance charge variants
• Vanquish UHPLC systems offer dependable, flexible,
and productive separations
Thermo Scientific™ Vanquish™ UHPLC
System & Orbitrap Exploris 240 MS
Speed and accuracy are key criteria for
laboratories performing charge variant
profiling with an out of the box sample
capacity of 216 samples. The Vanquish
UHPLC system and the Orbitrap Exploris
240 MS offers the speed and accuracy
required for charge variant profiling
Charge variant analysis
Full solutions from mobile phase preparation to purpose-built software
Webinar - Taking Charged Variant Analysis to the next level
Heterogeneity of monoclonal antibodies
must be monitored and revealed by charge
sensitive techniques. Two workflows
specific to your needs:
1. Separation by charge followed by
mass spectrometry (CVA-MS) allows
for characterization of post-translational
modifications (PTMs) at the intact
protein level.
2. Salt gradient cation-exchange
chromatography can be used to
monitor mAb charge variants.
Vanquish™ UHPLC System
Obtain new benchmarks in accuracy,
precision and sensitivity in charge variant
analysis with the Thermo Scientific™
Vanquish™ UHPLC systems. Providing
biocompatibility with a state-of-the-art
quaternary or binary high-pressure solvent
blending, these ultra-high performance liquid
chromatography systems share all Vanquish
values, such as a design focused on uptime,
robustness and reliability
Characterization Routine monitoring
Learn more about peptide mapping
Value-added workflow benefits
• Automation options and kit-based protein
digestion for the reproducible results
• High throughput peptide mapping with
Vanquish Duo UHPLC system
• Complete product characterization:
Sequence coverage, PTMs, Disulfide bonds
and Sequence variants
Accurate peptide mapping is crucial for determining sequence coverage, identifying and
quantitating post-translational modifications, determining disulphide bonds, identifying sequence
variants, and performing de novo sequencing of proteins. Failure to accurately perform peptide
mapping can result in incomplete or incorrect protein characterization, compromising the safety
and efficacy of biologic products.
Webinar - Rapid Automated Peptide Mapping
Vanquish Tandem LC System &
Orbitrap Exploris 240 MS
The Vanquish Duo allows for tandem LC-MS. With
this approach, a greater number of sample injections
can be performed in the same timeframe, enhancing
throughput and significantly reducing MS idle time
Vanquish Tandem LC System &
Orbitrap Exploris 480 MS
Accurate mass and resolving power provide the most
effective way to accurately and confidently identify peptides.
Confident and complete sequence coverage with versatile
Thermo Scientific™ BioPharma Finder™ software
Thermo Scientific™ KingFisher™
Duo Prime Purification System
Thermo Scientific™ SMART Digest™ Kit provides
fast and simple protein digestion with high
reproducibility and sensitivity, in a format that’s
compatible with automation
Peptides
Peptide mapping
High throughput peptide mapping with Vanquish Duo UHPLC system
Characterization
12 13 Learn more about Multi-Attribute Method
Value-added workflow benefits
• Seamless and direct method transfer from lab-to-lab
• End-to-end, compliance-ready platform for
deployment from development to QC
• Enterprise software platform for connectivity at global
scale leveraging the power of enterprise Chromeleon
and Ardia Platform software.
• Confident and consistent attribute identification and
monitoring with high resolution and accurate mass data
Webinar - Pfizer: Evaluation of the
Orbitrap Exploris MX Mass Detector
Multi-Attribute Method
A platform from discovery and development to QC
The Multi-Attribute Method (MAM) is a peptide mapping-based method used to quantify multiple potential
CQAs simultaneously. Thermo Scientific™ MAM 2.0 is a powerful high resolution accurate mass-based
workflow that enables comprehensive characterization and monitoring of quality attributes from research
to quality control (QC). MAM is in alignment with the QbD approach to the development of biopharmaceuticals,
which is advocated by regulatory agencies and is being adopted by biopharmaceutical companies.
Vanquish Flex or Horizon UHPLC System &
Thermo Scientific™ Orbitrap Exploris™ MX enables
confident monitoring of critical quality attributes
Thermo Scientific™ Vanquish™ Flex or Horizon
UHPLC System & Orbitrap Exploris 240 enables
comprehensive characterization of product quality attributes
Research & Development
Attribute Characterization | Product Quality Attribute Monitoring
Manufacturing & QC
Critical Quality Attribute Monitoring | New Peak Detection
Peptides with
or without PTMs
Thermo Scientific™
eWorkflow™
Characterization Routine monitoring
Digestion
Learn more about host cell protein analysis
Value-added workflow benefits
• Ready-to-use single informatics workflow for peptide
mapping and HCP data processing and visualization
• HRAM MS data combined with Thermo Scientific™
Proteome Discoverer™ software provides confident
HCP identifications
The analytical solution for Host Cell Protein (HCP) monitoring must be both robust and fast, and capable of
identifying and quantifying multiple HCPs in a single chromatographic separation. To meet the growing demand
for increased process understanding, scientists are turning to reliable UHPLC systems coupled with HRAM mass
spectrometers for accurate and reliable HCP monitoring throughout the purification process.
Video - Optimized sample preparation for low ppm detection of Host Cell
Proteins (HCPs) in biotherapeutics with Orbitrap-based MS detection
HCPs
• Increased sensitivity enabled by micro-flow rate separation
allows detection of low abundant HCPs
KingFisher Duo Prime
Purification System
Non-denaturing protein digestion with
SMART Digest kit reduces intra-sample
dynamic range and increases host cell
protein (HCP) identifications
Vanquish™ High-throughput LC systems &
Orbitrap Exploris 480 MS
Detection of HCPs ranging in concentrations from
<0.5 ppm to 200 ppm
Identify and quantify multiple HCPs in a single chromatographic
separation, allowing for reliable HCP monitoring throughout the
purification process
Vanquish™ Neo UHPLC System &
Thermo Scientific™ Orbitrap™ Astral™ MS
The Orbitrap Astral Mass Spectrometer helps
overcome the challenges of insufficient throughput,
low abundant HCP ID and provides sub ppm
quantification
Host cell protein analysis
Fast analysis achieved by harnessing the power of Orbitrap technology
Characterization
14 15
Complete characterization of
monoclonal antibodies under native
and denaturing conditions
This document provides a comprehensive overview of
the use of the Thermo Scientific Orbitrap Exploris 480
mass spectrometer equipped with BioPharma Option for
the full characterization of antibody samples. The primary
objective is to provide optimal LC-MS conditions to
achieve conclusive information on the molecular weight
and proteoform heterogeneity at the intact mAb, subunit,
and peptide levels.
A key challenge in analyzing therapeutic monoclonal
antibodies (mAbs) is the macro-heterogeneity deriving
from various N-linked glycan species and structural
heterogeneity deriving from various endogenous
modifications. These modifications contribute to
micro-heterogenous proteoform mixtures of covalently
assembled molecules, which vary in size, charge,
and hydrophobicity and could impact mAb chemical
properties.The solution to this challenge is the
application of different workflows for characterizing
biopharmaceuticals on the new LC-MS platform,
including intact mass analysis under native and
denaturing conditions, subunit analysis complemented
with Middle-Down analysis, and peptide mapping. The
Orbitrap Exploris 480 mass spectrometer equipped with
the BioPharma Option is used to achieve these analyses
with high sensitivity, scan speed, and resolution to
achieve results with the highest confidence.
Learn more about glycan analysis
Value-added workflow benefits
• Flexible solutions for all analytical strategies
• Fit for purpose sample preparation options
• HRAM MS for outstanding intact protein or
glycopeptide analysis
• Easy-to use fit for purpose software capabilities
from discovery to control
Glycan analysis
Comprehensive toolbox for glycan analysis
Analysis of glycans can be complex as no single method will provide all information, but there
are many different approaches for glycan analysis. Thermo Fisher Scientific offer full solutions to
analyze glycans utilizing UHPLC, UHPLC-MS and IC for analysis of glycoforms.
Webinar - Advancing carbohydrate analysis - Glycans
Thermo Scientific™ Orbitrap™ Ascend Tribrid™
Biopharma mass spectrometer
Quantify more samples at lower concentrations using
faster acquisition, while achieving greater coverage
using a revolutionary new hardware design featuring
dual ion routing multipoles
OR
Glycans Vanquish UHPLC System & Orbitrap Exploris Platform or
Thermo Scientific™ ICS-6000 ™ Ion Chromatography system
Monitor released N- & O-glycan without labelling
Flexibility: Ion chromatography with pulsed amperometric detection (HPAEPAD) OR LC with charged aerosol detection (CAD)
Characterization Routine monitoring
HCD
Intact native
Intact denatured
Subunits
Peptide mapping Top/Middle-Down
Application Note - View the PDF
Application note spotlight
16 17
Seamless LC-MS method transfer in
a biopharmaceutical development
laboratory
Symphogen, a Denmark-based biopharmaceutical
company, employs an LC-MS system, made up of a
Thermo Scientific Vanquish Horizon Duo UHPLC and
Thermo Scientific Q Exactive Plus hybrid quadrupoleOrbitrap mass spectrometer, for the development and
lead selection studies of complex therapeutic proteins
and protein mixtures. Recently, Symphogen aimed to
augment their laboratory capabilities by introducing a
new generation benchtop Orbitrap-based high-resolution
accurate mass (HRAM) mass spectrometer, the Thermo
Scientific Orbitrap Exploris 480 mass spectrometer.
• The primary challenge was to ensure the transfer
of the execution of the native mass analysis
measurements hyphenated to size exclusion
chromatography (SEC-MS) from the Q Exactive Plus
MS to the new Orbitrap Exploris 480 MS. The new
MS platform had to deliver consistent high-quality
data, comparable to the existing Q Exactive Plus MS
system, across hundreds of samples in each lead
selection study.
• The solution involved a systematic evaluation and
optimization of method parameters on the Orbitrap
Exploris 480 MS to generate high-quality data
comparable to the Q Exactive Plus MS platform.
Figure 6 shows the assessment of robustness
through the investigation of glycoform level
determination reproducibility. The results demonstrate
the new platform’s robustness, with remarkably low
variability and %CV values, thus ensuring a seamless
method transfer between the two platforms.
Application note spotlight
4 × 96-well plates Vanquish Duo UHPLC System
for tandem LC or LC-MS
Q Exactive Plus MS with
BioPharma Option
Instrument control and data
processing in Chromeleon CDS
5000 5200 5400 5600 5800 6000 6200 6400 6600
0
10
20
30
40
50
60
70
80
90
100Relativ e Abundance
G0F/G0F
G0F/G1F
G0F/G2F
147500 148000 148500
Orbitrap Exploris 480 MS
with BioPharma Option
• Instrument control and data
processing for ID testing in
Chromeleon CDS
• For method optimization, including
assigment and quantitation of
glycoforms/proteoforms data
processing with Protein Metrics
Byos software
5000 5200 5400 5600 5800 6000 6200 6400 6600
0
10
20
30
40
50
60
70
80
90
100Relativ e Abundance
G0F/G0F
G0F/G1F
G0F/G2F
147500 148000 148500
A)
B)
Vanquish Duo UHPLC System
for tandem LC or LC-MS
4 × 96-well plates
Application Note - View the PDF Confident peptide mapping and
disulfide bond analysis of an IgG2
monoclonal antibody
The document discusses an application brief related to
peptide mapping and disulfide bond analysis of an IgG2
monoclonal antibody, denosumab, using the Thermo
Scientific Orbitrap Exploris 240 mass spectrometer.
The primary goal was to demonstrate the utility and
capability of the mass spectrometer for the routine
characterization of biotherapeutics through LC-MS
peptide mapping. This procedure allows for the full
sequence coverage, high confidence in low level posttranslational modifications (PTMs) identification, and
ease in interpreting complex data
• The major challenge in the biopharmaceutical
industry is ensuring the quality, efficacy, and safety
of biotherapeutic proteins, such as monoclonal
antibodies, due to variations in production processes
and the intrinsic complexity of these proteins. There
are many critical quality attributes (CQAs) that must
be monitored, including the detection of inter- and
intrachain disulfide bonds and low-level posttranslational modifications (PTMs). Additionally, the
industry requires instruments and analytical methods
that can be transferred and adopted routinely across
organizations.
• The Orbitrap Exploris 240 mass spectrometer
provides operational simplicity and flexibility,
enabling a wide range of characterization assays
to be performed with high confidence. It was used
to perform peptide mapping analysis to confirm
100% sequence coverage of denosumab, enabling
the detection of low-level PTMs and the location of
disulfide bonds.
Application note spotlight
1:C23/1:C89
2:C368/2:C426
1:C135/1:C195
2:C149/2:C205
2:C22/2:C96
1:C215/2:C136
2:C262/2:C322
2:C224, C225, C228, C231/2:C224,
C225, C228, C231
6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33
Minutes
10
20
30
40
50
60
70
80
90
100
Relative Abundance S-S bond type Position Δ ppm RT
Intrachain
LC1 ATLSCR / LEPEDFAVFYCQQYGSSPR 1:C23/1:C89 -1.2 25.95
LC2 SGTASVVCLLNNFYPR / HKVYACEVTHQGLSSPVTK 1:C135/1:C195 -2.1 24.15
HC1 LSCAASGFTFSSYAMSWVR / AEDTAVYYCAK 2:C22/2:C96 -2.7 28.95
HC2 STSESTAALGCLVK /
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTK 2:C149/2:C205 -0.9 32.54
HC3 TPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK / CK 2:C262/2:C322 -0.6 26.76
HC4 NQVSLTCLVK / WQQGNVFSCSVMHEALHNHYTQK 2:C368/2:C426 0.4 22.87
Interchain
LC-HC GEC / GPSVFPLAPCSR 1:C215/2:C136 -2.5 21.86
Hinge KCCVECPPCPAPPVAGPSVFLFPPKPK / KCCVECPPCPAPPVAGPSVFLFPPKPK 2:C224, C225, C228, C231/
2:C224, C225, C228, C231 -0.02 28.05
Peptide sequence
Application Note - View the PDF
18 19
IdeS-cleaved mAb subunit analysis
with LC-HRAM-MS: a quick and
accurate comparison of biosimilar
and originator biotherapeutics
The document discusses the application of a middle-up
approach for the characterization of biotherapeutics,
using the Thermo Scientific Q Exactive Plus Hybrid
Quadrupole-Orbitrap mass spectrometer. This technique
is crucial for the fast and reliable characterization of
monoclonal antibody variants and modifications, which
is of paramount importance in the biopharmaceutical
industry.
• The key challenge in the biopharmaceutical industry
is to establish the quality and safety of biosimilar
therapeutics, which are drugs with minimal variations
from their originator. These variations can occur due
to multiple factors, including expression system,
growing conditions, purification steps, or final
formulations. Therefore, it is crucial to monitor and
quantify these variations to correlate them to any
potentially different in vivo activity, such as different
clearance time or other interactions within the patient.
• The solution to this challenge is the use of a middleup approach, which involves the use of liquid
chromatography hyphenated with high-resolution,
accurate-mass spectrometry (LC-HRAM-MS) for the
comparison of monoclonal antibody drug substances
and their respective biosimilars. This approach
minimizes sample handling and artifacts and provides
quicker or complementary information. As illustrated
in Figure 2, the LC-MS analysis of IdeS digested
bevacizumab biosimilar provided high quality data,
which allowed for a confident identification and
sequence verification of light chain and Fd region
and a rapid analysis of Fc region variants, including
glycoform and N-terminal lysine loss.
Relative Intensity
0
10
23942.8376
23428.5729
+ LVTNS
∆ppm: 1.6
20
30
40
50
60
70
80
90
100
Mass
23000 23200 23400 23600 23800 24000 24200
Application Note - View the PDF
Proton transfer charge reduction
(PTCR)
This document provides a comprehensive overview of the
experiments conducted for the analysis of monoclonal
antibody (mAb) subunits under denaturing conditions.
The experiments utilize Liquid Chromatography (LC) and
Mass Spectrometry (MS) analysis with various reagents,
columns, solvents, and flow rates. The document details
the LC conditions, MS conditions, data analysis, results,
and discussion.
• The primary challenge in this context is the
characterization of the primary sequence of
biotherapeutics, specifically monoclonal antibodies
(mAbs). Traditional methods such as Bottom-Up
Mass Spectrometry (BU MS) and Top-Down Mass
Spectrometry (TD MS) have limitations in terms of
sequence coverage and the complexity of MS2
spectra, especially for larger mAb subunits.
• The solution proposed in this document is the
application of Proton Transfer Charge Reduction
(PTCR) in conjunction with Electron Transfer
Dissociation (ETD) for middle-down analysis of mAbs.
This approach simplifies fragment ion spectra, leading
to improved sequence coverage and increased
confidence in product ion matching.
…CPPCPAPELLG GPSVF…
Reduction
(TCEP/DTT)
F(ab’)2
Fc
~ 50 kDa
~ 100 kDa IdeS
~ 25 kDa
~ 25 kDa
2x Fd’
~ 25 kDa
2x Fc/2
2x Lc
Mannose Fucose N-acetylglucosamine
A
B
Time (min)
6.0 8.0 10.0 12.0
Fc/2 Lc
Fd’
800 1000 1200 m 1400 1600 1800 /z
1147.6 m/z 1148.6
20+
Monoisotopic mass
(theoretical)
Monoisotopic mass
(experimental)
ΔM (ppm)
22,928.1799
22,928.09975
+3.5 ppm
Application Note - View the PDF
Application note spotlight Application note spotlight
Resources
BioPharma learning center
Peptide mapping
Glycan analysis
Host cell protein analysis
Subunit analysis
Native intact mass analysis
Protein aggregate analysis
Charged variant analysis
Multi-attribute method
Higher order structure analysis
Protein homepage
Find the column for your application
Biopharma webinar portal, searchable by application
© 2024, 2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified. It is not intended
to encourage use of these products in any manners that might infringe the intellectual property rights of others. EB003484 0325
Learn more at thermofisher.com/byyourside
Download the eBook for FREE Now!
Information you provide will be shared with the sponsors for this content. Technology Networks or its sponsors may contact you to offer you content or products based on your interest in this topic. You may opt-out at any time.
Experiencing issues viewing the form? Click here to access an alternate version